PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65790.1
Common NameATMYB68, F6H11.100, MYB68
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 374aa    MW: 41841.7 Da    PI: 6.1051
Description myb domain protein 68
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++  G+g +W + ++++g++R++k+c++rw++yl
      AT5G65790.1 14 KGPWSPEEDAKLKDYIENSGTGgNWIALPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.7e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
      AT5G65790.1  69 GGFSEEEDNIICNLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.624962IPR017930Myb domain
SuperFamilySSF466891.06E-2511109IPR009057Homeodomain-like
SMARTSM007177.9E-111364IPR001005SANT/Myb domain
PfamPF002494.7E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231569IPR009057Homeodomain-like
CDDcd001671.32E-71662No hitNo description
PROSITE profilePS5129421.38563117IPR017930Myb domain
SMARTSM007172.2E-1167115IPR001005SANT/Myb domain
PfamPF002496.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370117IPR009057Homeodomain-like
CDDcd001675.11E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE NSGTGGNWIA LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC NLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLNK  120
QRKEFQEARM KQEMVMMKRQ QQGQGQGQSN GSTDLYLNNM FGSSPWPLLP QLPPPHHQIP  180
LGMMEPTSCN YYQTTPSCNL EQKPLITLKN MVKIEEEQER TNPDHHHQDS VTNPFDFSFS  240
QLLLDPNYYL GSGGGGEGDF AIMSSSTNSP LPNTSSDQHP SQQQEILQWF GSSNFQTEAI  300
NDMFINNNNN IVNLETIENT KVYGDASVAG AAVRAALGGG TTSTSADQST ISWEDITSLV  360
NSEDASYFNA PNHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109160.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247165_at0.0
Expression AtlasAT5G65790-
AtGenExpressAT5G65790-
ATTED-IIAT5G65790-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative MYB transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274720.0AK227472.1 Arabidopsis thaliana mRNA for transcription factor like protein, complete cds, clone: RAFL14-10-M08.
GenBankAY5196470.0AY519647.1 Arabidopsis thaliana MYB transcription factor (At5g65790) mRNA, complete cds.
GenBankBT0059940.0BT005994.1 Arabidopsis thaliana At5g65790 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201380.10.0myb domain protein 68
SwissprotQ9M2Y91e-129RAX3_ARATH; Transcription factor RAX3
TrEMBLO495380.0O49538_ARATH; At5g65790
STRINGAT5G65790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Keller T,Abbott J,Moritz T,Doerner P
    Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.
    Plant Cell, 2006. 18(3): p. 598-611
    [PMID:16473968]
  7. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]